CD40 His Tag Protein, Mouse
SKU: 9419656867

CD40 His Tag Protein, Mouse

Sale price$234.00 Regular price$260.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD40 His Tag Protein, MouseProduct Specification Species Mouse Synonyms CD40, Bp50, CDW40, MGC9013, TNFRSF5, p50 Accession P27512 Amino Acid Sequence Val24 Arg193, with C terminal 8*His VTCSDKQYLHDGQCCDLCQPGSRLTSHCTALEKTQCHPCDSGEFSAQWNREIRCHQHRHCEPNQGLRVKKEGTAESDTVCTCKEGQHCTSKDCEACAQHTPCIPGFGVMEMATETTDTVCHPCPVGFFSNQSSLFEKCYPWTSCEDKNLEVLQKGTSQTNVICGLKSRMRGGGSHHHHHHHH Expression System HEK293 Molecular Weight 22 27kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation

Product Specification


Species Mouse
Synonyms CD40, Bp50, CDW40, MGC9013, TNFRSF5, p50
Accession P27512
Amino Acid Sequence Val24-Arg193, with C-terminal 8*His VTCSDKQYLHDGQCCDLCQPGSRLTSHCTALEKTQCHPCDSGEFSAQWNREIRCHQHRHCEPNQGLRVKKEGTAESDTVCTCKEGQHCTSKDCEACAQHTPCIPGFGVMEMATETTDTVCHPCPVGFFSNQSSLFEKCYPWTSCEDKNLEVLQKGTSQTNVICGLKSRMRGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 22-27kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Chatzigeorgiou A. et al. (2009) CD40/CD40L signaling and its implication in health and disease. Biofactors. 35(6): 474-483.

2、Li R. et al. (2009) Expression of CD40 and CD40L in Gastric Cancer Tissue and Its Clinical Significance. Int J Mol Sci. 10(9): 3900-3917.

3、Lievens D. et al. (2009) The multi-functionality of CD40L and its receptor CD40 in atherosclerosis. Thromb Haemost. 102(2): 206-214.

Background

CD40 is also known as TNFRSF5, Bp50, CDW40, MGC9013, TNFRSF5 and p50, is a member of the TNF receptor superfamily which are single transmembrane-spanning glycoproteins, and plays an essential role in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. CD40 is a costimulatory protein found on antigen presenting cells and is required for their activation. The binding of CD154 (CD40L) on TH cells to CD40 activates antigen presenting cells and induces a variety of downstream effects. CD40 contains 4 cysteine-rich repeats in the extracellular domain, and is expressed in B cells, dendritic cells, macrophages, endothelial cells, and several tumor cell lines. Interaction of CD40 with its ligand, CD40L, leads to aggregation of CD40 molecules, which in turn interact with cytoplasmic components to initiate signaling pathways. Early studies on the CD40-CD40L system revealed its role in humoral immunity. Both CD40 and CD40 L have a membrane form and a soluble form generated by proteolytic cleavage or alternative splicing. CD40 and CD40L are widely expressed in various types of cells, among which B cells and myeloid cells constitutively express high levels of CD40, and T cells and platelets express high levels of CD40L upon activation. CD40L self-assembles into functional trimers which induces CD40 trimerization and downstream signaling. CD40/CD40L immune checkpoint leads to activation of both innate and adaptive immune cells via two-way signaling. CD40/CD40L interaction also participates in regulating thrombosis, tissue inflammation, hematopoiesis and tumor cell fate. The mechanisms of benefits include immune cell activation and tumor cell lysis/apoptosis in malignancies, or immune cell inactivation in autoimmune diseases and allograft rejection.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 9419656867

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 1007 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
Layton Phillips
Belleville, US
★★★★★ 5
Great pillow, but the cooling effect depends on the cover
Color: Blue-ice Plus, Size: King(Pack of 2)
I really like this pillow overall. It’s comfortable, supportive, and feels well made. When you use it without a pillowcase, it definitely feels cool to the touch and does what it claims in terms of that initial cooling sensation. However, once you put a pillowcase on it, you can’t really feel the cooling effect anymore. I’ve tried multiple different pillowcases made from different materials, and none of them really let that cool feeling come through. That said, I still love the pillow itself. It’s comfortable and supportive enough that I’m keeping it. Just keep in mind that the cooling feature works best without a cover, which isn’t ideal for everyone. Overall, a good pillow — just manage expectations about the cooling effect once it’s covered.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 17, 2026
H
Verified Purchase
Hannah N. Ford
West Palm Beach, US
★★★★★ 5
Cooling and holds shape.
Color: Blue-ice Plus, Size: Queen(Pack of 2), Color: Blue-ice Plus, Size: Queen(Pack of 2)
Very nice pillow for the price is also holding up well and holding shape very cool and comfortable to the touch. Best pillow I found in a long time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
S
Verified Purchase
smmt
Lexington, US
★★★★★ 5
Best Pillow Ever
Color: Blue-ice Plus, Size: Queen(Pack of 2)
Best pillow ever. Although it still gets "hot", it does take longer to get "hot". I love this pillow. I was buying a new pillow almost every 3 months. Other pillows would either remain rock hard or go flat. I was concerned at first when reading the description as I though the memory foam would be big pieces. They are soft fluffy pieces. I had to remove almost half of the foam to get the pillow to what works for me. I have not had to put any filler back in. Maybe in a couple of more months I may have to put a bit more in, but it is holding it's shape and not going flat. I do fluff it every night. This helps. I am a stomach sleeper. I have bought the expensive purple pillow and hated it so much I gave it to my daughter. This QUTOOL Pillow is the best! I bought a 2 pack. Have not used the other pillow yet, but I feel I may actually go years for once without having to buy a pillow as I have the 2nd one set aside if the first one gets to a point in need replacement. I have bought Dollar Store pillows. I have bought $300 pillows. None of them even come close to this pillow and the way you can adjust this pillow for you. The pillows came in a white mesh like bag. I keep all the unused "stuffing" in this bag. I have it hanging in my closet and I just fluff the bag once a month to keep the filling fresh so it is ready if and when I need it. Coming from someone who has trouble staying asleep, neck issues, a stomach sleeper who hate those flat pillows manufacturers think stomach sleepers like but actually hate, buy this pillow. Just buy it. Best Pillow for a picky person like me. Buy 2 or more so if you have to stay at a hotel, you can take your own pillow.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 15, 2025
J
Verified Purchase
Jedata
Cuba, US
★★★★★ 4
Slippery Pillow
Color: Blue-ice Plus, Size: Queen(Pack of 2)
Nice and cooling but it’s so slick my pillow sheet doesn’t want to stay on.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026
J
Verified Purchase
Jute
Port Orchard, US
★★★★★ 5
Foam Mattress NEEDs Foam Pillows
Color: Blue-ice Plus, Size: King(Pack of 2), Color: Blue-ice Plus, Size: King(Pack of 2)
10 stars!! Quality foam, structure & price. Best bang for my buck.    HRV, readiness & total sleep score metrics increased drastically this week.  See screenshot :) Support: Molds and cushions every crevice under my neck and above shoulders. So comfy  Size: Adjustable loft but king length is perfect to hug and rest your head.  Love love love. The 1st 2 nights were uncomfortable with pillow as is, first night I was up at 3am half asleep pulling foam out but wasn't enough. The second night at 2am I pulled out more stuffing. I was getting frustrated..  my Oura ring showed both nights I was awake every hour.  Not good.  Before the 3rd night I pulled enough to fill the bag the 2 pillows arrived in. Boom -8hrs sleep and for the first time ii years I achieved 17% Deep sleep.  Huge. Weight: Perfect weight with adjustment. Squishy and molds to b the contour of my neck and shoulders Softness: Like the baby bear.. just right.   Comfort: Very comfortable after removing 30% foam in both pillows. I actually now have enough to make a 3rd pillow, replace old foam, or adjust OGs, Still to early to measure.  If you have a foam mattress that contours your body but not your head you'll end up with neck and/or back pain from head being elevated- not sinking/molding the body into a foam mattress. 
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 1, 2025

recommand products