MARCO His Tag Protein, Mouse
SKU: 28553256780

MARCO His Tag Protein, Mouse

Sale price$277.20 Regular price$308.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

MARCO His Tag Protein, MouseProduct Specification Species Mouse Synonyms MARCO, SCARA2, Macrophage receptor with collagenous structure, Scavenger receptor class A member 2 Accession Q60754 Amino Acid Sequence Gln70 Ser518, with N terminal 10*His

Product Specification


Species Mouse
Synonyms MARCO, SCARA2, Macrophage receptor with collagenous structure, Scavenger receptor class A member 2
Accession Q60754
Amino Acid Sequence Gln70-Ser518, with N-terminal 10*His HHHHHHHHHHGGGSGGGSQVLNLQEQLQMLEMCCGNGSLAIEDKPFFSLQWAPKTHLVPRAQGLQALQAQLSWVHTSQEQLRQQFNNLTQNPELFQIKGERGSPGPKGAPGAPGIPGLPGPAAEKGEKGAAGRDGTPGVQGPQGPPGSKGEAGLQGLTGAPGKQGATGAPGPRGEKGSKGDIGLTGPKGEHGTKGDKGDLGLPGNKGDMGMKGDTGPMGSPGAQGGKGDAGKPGLPGLAGSPGVKGDQGKPGVQGVPGPQGAPGLSGAKGEPGRTGLPGPAGPPGIAGNPGIAGVKGSKGDTGIQGQKGTKGESGVPGLVGRKGDTGSPGLAGPKGEPGRVGQKGDPGMKGSSGQQGQKGEKGQKGESFQRVRIMGGTNRGRAEVYYNNEWGTICDDDWDNNDATVFCRMLGYSRGRALSSYGGGSGNIWLDNVNCRGTENSLWDCSKNSWGNHNCVHNEDAGVECS
Expression System HEK293
Molecular Weight 58-70kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

MARCO (macrophage receptor with collagenous structure), also known as SCARA2, is an 80 kDa type II transmembrane glycoprotein that belongs to the class A scavenger receptor family. MARCO is constitutively expressed on the surface of splenic and lymph node macrophages. Its expression is induced on Kupffer cells and alveolar macrophages by microbial infection, chemical irritants, and Th1 polarizing factors. MARCO binds LPS, lipoteichoic acid, and other determinants on Gram positive and negative bacteria. It also binds modified LDL, CpG oligonucleotides, UGRP1, silica, and TiO2. MARCO is required for the organization of the splenic marginal zone and the interaction of local macrophages and B cells.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 28553256780

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 1374 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Barb W
Bozeman, US
★★★★★ 3
Stains easily. Tight for men's size 11 feet
Flavor Name: XL silicone socks 2 pairs, Flavor Name: XL silicone socks 2 pairs
Husband wore dark cotton socks over these gel foot covers overnight and the covers picked up color from the socks. Tried hand washing, even dabbing with a bleach soaked paper towel, but the stains remained. The covers are a bit tight for men's size 11. Edit: After a few more hand washings the stains began to fade. However one tore around the leg opening when taking it off.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 10, 2024
D
Verified Purchase
DD
Draper, US
★★★★★ 1
Worthless. Tore on first use.
Flavor Name: XL silicone socks 2 pairs
The first time I put these on my feet, the whole toe broke right through. They were a proper fit and my feet are well pedicured. Just very poor quality. I don’t recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 2, 2024
P
Verified Purchase
Pat Belanger
Natrona Heights, US
★★★★★ 5
Best fit!
Flavor Name: XL silicone socks 2 pairs
Search no further, these are the BEST! They are smazing at conforming to the shape of your feet. They fit snuggly with no sags/bags or uncomfortable pressure or squeezing of your toes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 8, 2025
T
Verified Purchase
Tasha U
Phoenix, US
★★★★★ 4
Helps dry, cracked feet
Flavor Name: XL silicone socks 2 pairs
We use these on my husband’s cracked feet in the winter and put on a thick cream under these socks. They are nice because hair, dirt and that kind of stuff doesn’t stick to the outside. I do wish them came in more sizes and colors. They were a little small for my husband, but still worked good enough. My husband isn’t thrilled about wearing pink socks around the house. At least it’s just around the house and not out in public though.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 6, 2025
K
Verified Purchase
KB
Draper, US
★★★★★ 5
Be aware! Once they are on, do not walk! 😂
Flavor Name: XL silicone socks 2 pairs
I absolutely love these things. But the first time I put them on in the living room. The walk to my bedroom was VERY interesting 😂😂😂 I now know I need to put them on and hang out for a bit, or simply go to bed. They do exactly what I need them to do. Feet feel great afterwards! With the right lotion, only need to use one every couple of weeks.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 10, 2025

recommand products