TSLP (R127A, R130A) His Tag Protein, Human
SKU: 90430905807

TSLP (R127A, R130A) His Tag Protein, Human

Sale price$220.50 Regular price$245.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

TSLP (R127A, R130A) His Tag Protein, HumanProduct Specification Species Human Antigen TSLP Synonyms Thymic stromal lymphopoietin Accession Q969D9 Amino Acid Sequence Tyr29 Gln159(Arg127Ala, Arg130Ala), with C terminal 10* His YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKARKAKVTTNKCLEQVSQLQGLWRRFNRPLLKQQGGGSGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight 22 2 kDa (Reducing) Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation

Product Specification


Species Human
Antigen TSLP
Synonyms Thymic stromal lymphopoietin
Accession Q969D9
Amino Acid Sequence

Tyr29-Gln159(Arg127Ala, Arg130Ala), with C-terminal 10* His YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKARKAKVTTNKCLEQVSQLQGLWRRFNRPLLKQQGGGSGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

22-2 kDa (Reducing)

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1. Luo J, Zhu Z, Zhai Y, Zeng J, Li L, Wang D, Deng F, Chang B, Zhou J, Sun L. The Role of TSLP in Atopic Dermatitis: From Pathogenetic Molecule to Therapeutical Target. Mediators Inflamm. 2023 Apr 15;2023:7697699. 2. 2.Lu H, Wu X, Peng Y, Sun R, Nie Y, Li J, Wang M, Luo Y, Peng L, Fei Y, Zhou J, Zhang W, Zeng X. TSLP promoting B cell proliferation and polarizing follicular helper T cell as a therapeutic target in IgG4-related disease. J Transl Med. 2022 Sep 8;20(1):414.

Background

Thymic stromal lymphopoietin (TSLP) acts as a hemopoietic cytokine, proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain. It mainly impacts myeloid cells and induces the release of T cell-attracting chemokines from monocytes and enhances the maturation of CD11c(+) dendritic cells. The protein promotes T helper type 2 (TH2) cell responses that are associated with immunity in various inflammatory diseases, including asthma, allergic inflammation and chronic obstructive pulmonary disease. It is positively associated with AD deterioration. Mainly secreted by keratinocytes, TSLP interacts with multiple immune cells (including dendritic cells, T cells, and mast cells), following induction of Th2-oriented immune response during the pathogenesis of AD.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90430905807

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 2109 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
Lseñor
Lexington, US
★★★★★ 5
I have always purchased Asurion and they have always come through
Asurion really came through for me when I had an issue with my Canon printer. The process was smooth and easy from start to finish. The only small challenge was finding a box big enough to ship the printer, but once I had that, I just attached the label they sent and dropped it off at UPS. They kept me updated by email every step of the way, and after inspecting the printer, they determined it couldn’t be fixed. The next day, I received a full reimbursement. Excellent communication and great service all around!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 27, 2025
D
Verified Purchase
Debrah E.
Whiting, US
★★★★★ 5
Great Experience!
I have never had to deal with Asurion before and was pleasantly surprised at how well the process went and at no additional cost to me. I shipped my printer on the 14th and it arrived back to me on the 21st, problem resolved. GREAT experience!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 2, 2025
A
Verified Purchase
Amy
Omaha, US
★★★★★ 5
Good insurance to have
Asurion was great. After a few simple questions about what was going on with the unit, they issued a mailing label. Within 3 days of receiving the faulty unit they issued an Amazon gift card for the original purchase price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 27, 2025
G
Verified Purchase
GUSTAVO Arriens
Los Angeles, US
★★★★★ 5
Simple and not Drama claim process.
’ve had Asurion coverage for a couple of years and never needed to use it until recently, when my pool salt cell (less than two years old) stopped working. I had purchased it with an Asurion protection plan, so I contacted them to start a claim. The process was simple and straightforward to follow. In the end, they honored the plan and covered the cost of my salt cell based on the value when I originally bought it. They issued me a gift card that I could use on Amazon for that amount. While prices have gone up and a new cell now costs about $200 more, it was still definitely worth having the coverage. Overall, I’m satisfied with how the claim was handled.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 8, 2026
L
Verified Purchase
lele
Lowell, US
★★★★★ 5
Love this protection plan
Quick and easy. My daughter's cracked her screen on her phone, as soon as it happened I went on the app, filed the claim. Ten minutes later I received the email with the shipping lable. The following day I dropped the phone off at ups and 4 hours later I received the digital gift card. Ive filed several claims since getting the protection plan and with four kids its definitelysomething im glad to have especially since i dont have to buy a protectionplan for each item now. I have filed claims for electric scooter the stoped working for no reason, my son's phone stopped charging, my oldest daughter cracked her phone screen, my son's video game controllers up and died and each time it was quick and easy and no fuss
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026

recommand products