B7-H7/HHLA2 His Tag Protein, Human
SKU: 34748764792

B7-H7/HHLA2 His Tag Protein, Human

Sale price$216.00 Regular price$240.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

B7-H7/HHLA2 His Tag Protein, HumanProduct Specification Species Human Synonyms B7 H7, HHLA2, B7 Homolog 7 Accession Q9UM44 Amino Acid Sequence Ile23 Asn344, with C terminal 8*His

Product Specification


Species Human
Synonyms B7-H7, HHLA2, B7 Homolog 7
Accession Q9UM44
Amino Acid Sequence Ile23-Asn344, with C-terminal 8*His IFPLAFFIYVPMNEQIVIGRLDEDIILPSSFERGSEVVIHWKYQDSYKVHSYYKGSDHLESQDPRYANRTSLFYNEIQNGNASLFFRRVSLLDEGIYTCYVGTAIQVITNKVVLKVGVFLTPVMKYEKRNTNSFLICSVLSVYPRPIITWKMDNTPISENNMEETGSLDSFSINSPLNITGSNSSYECTIENSLLKQTWTGRWTMKDGLHKMQSEHVSLSCQPVNDYFSPNQDFKVTWSRMKSGTFSVLAYYLSSSQNTIINESRFSWNKELINQSDFSMNLMDLNLSDSGEYLCNISSDEYTLLTIHTVHVEPSQETASHNGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 51-67kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Zhu Y. et al. (2013) B7-H5 costimulates human T cells via CD28H. Nat Commun. 4: 2043.

2、Dong Z. et al. (2018) EGFR may participate in immune evasion through regulation of B7-H5 expression in non-small cell lung carcinoma. Mol Med Rep. 18: 3769-3779.

Background

Human endogenous retrovirus-H long terminal repeat-associating protein 2 (HHLA2; also known as B7H7 or B7H5) is the only member of the B7 protein family found in humans. HHLA2 cannot be found in mice and is mainly expressed in human breast, lung, thyroid, melanoma, pancreas, ovary, liver, bladder, colon, prostate, kidney and esophagus cancer cells, activated myeloid cells, monocyte-derived macrophages and dendritic cells. In addition, HHLA2 interacts with the co-receptor CD28H to stimulate T cell proliferation, differentiation and the production of cytokines, including IFN-γ, IL-2 and IL-10. In terms of cancer, higher expression levels of HHLA2 were previously reported to be associated with poorer prognoses or higher degrees of tumour invasion in lung carcinoma, hepatocellular carcinoma and prostate cancer.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 34748764792

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 2248 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Ms Rene Butts
Charlottesville, US
★★★★★ 5
Nice colors
Color: Yellow
This was a perfect choice for my iPad. The color is very vibrant easy to put on and its sturdy will buy again in another color.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2026
B
Verified Purchase
Bernie
Grantham, US
★★★★★ 5
Keyboard is magnetic to cover so it doesn’t fall out
Color: Pink
Absolutely love this ! My iPad fits perfectly in this and the keyboard is touch sensitive which I like and the color combo on the keyboard makes it fun ! Definitely will recommend this
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 11, 2026
K
Verified Purchase
Kat
Birmingham, US
★★★★★ 5
Great quality case and keyboard
Color: Purple, Color: Purple
Super good quality case, I was actually surprised since it’s such a good price. It fit my 10.9 inch perfectly! Keyboard has magnetic attachment to the case which is super handy, and it connected with Bluetooth seamlessly. Keyboard isn’t silent, it’s on the louder side, but not too loud at all and it doesn’t bother me at all because I prefer clickier keyboards. Oh also something that’s really cool is that you can change the colors of the keyboard, love that!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 10, 2026
U
Verified Purchase
User123456
Louisville, US
★★★★★ 5
Amazing!
Color: Midnight Green
The Hamile Keyboard Case for iPad (11th & 10th Generation) is a practical accessory for turning your iPad into a more laptop-like setup. Designed with a detachable wireless keyboard and protective case, it’s aimed at students, professionals, and anyone who types frequently on their tablet. One of its most appealing features is the 7-color backlit keyboard, which makes typing easier in low-light environments while also adding a customizable, stylish look. The backlighting can usually be adjusted in brightness and color, making it both functional and fun to use. The keys are generally responsive and comfortable enough for everyday typing tasks like emails, notes, and document work. The case itself provides decent protection for the iPad, helping guard against scratches and minor bumps. It also holds the tablet at a stable viewing angle, which is useful for video calls, studying, or streaming. The wireless connection is typically simple to set up via Bluetooth, and the keyboard can be detached when not needed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
A
Verified Purchase
Ari Love
Alexandria, US
★★★★★ 5
No need to tap my Nails on the screen anymore!
Color: Pink, Color: Pink
Cute, convenient, and definitely needed! I use it every day to carry my emotional support device The keyboard case is sturdy, easy to use, and makes it so much more convenient to take my my girl everywhere. Extra added protection! (I’m clumsy and my iPad has fell quite a few times!) the keyboard works great, I typed a lot of emails and docs! Very happy with this purchase!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 5, 2026

recommand products