Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 8 - Jul 13
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
TNFRSF10B/TRAIL R2 Fc Chimera Protein, MouseProduct Specification Species Mouse Antigen TNFRSF10B TRAIL R2 Synonyms TNFRSF10B,TRAILR2,TRAIL R2,CD262,DR5,KILLER,TRICK2,ZTNFR9 Accession Q9QZM4 Amino Acid Sequence Asn53 Ser177, with C terminal Mouse IgG Fc
Product Specification
| Species | Mouse |
| Antigen | TNFRSF10B/TRAIL R2 |
| Synonyms | TNFRSF10B,TRAILR2,TRAIL-R2,CD262,DR5,KILLER,TRICK2,ZTNFR9 |
| Accession | Q9QZM4 |
| Amino Acid Sequence | Asn53-Ser177, with C-terminal Mouse IgG Fc NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWASIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Expression System | HEK293 |
| Molecular Weight | 45-60kDa (Reducing) |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | Human Fc Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1.Walczak, H. et al. (1997) EMBO J. 16:5386. |
Background
TNFRSF10B, also called TRAIL R2 and DR5, is a member of the TNF receptor superfamily.TRAIL-R2 contains two extracellular cysteine-rich repeats, typical for TNF receptor (TNFR) family members, and a cytoplasmic death domain. TNFRSF10B / DR-5 is widely expressed in adult and fetal tissues; very highly expressed in tumor cell lines. Human and mouse TRAIL R2 share 49% amino acid sequence similarity. Some studies have suggested that TNFRSF10B contributes more than TNFRSF10A (TRAIL R1) to TRAIL-induced apoptosis in cancer cells that express both receptors. In addition, agonistic monoclonal antibodies against TNFRSF10B, which can induce apoptosis in the absence of TRAIL, are used for cancer therapies.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.1 ★★★★★
Based on 936 reviews
Sort
Product Reviews
★★★★★ 3
Wrong item ships/decent pillow/price unjustified
Size: Standard/Queen (Pack of 1), Style: Standard Loft (4" - 5")
Sent me the wrong pillow twice in a row. It said high loft and standard loft on the packing, not sure what the problem is. I ordered standard loft both times, and both times they sent high loft. That name is very deceiving though. If what I have is high loft, the standard loft wouldn’t be much thicker than your standard flat down pillow. If you’d like any sort of neck support I’d suggest starting with the high loft and going down instead of the other way around. I am 5’ 7” 130lbs and this pillow does not lift my neck up further than neutral, which is a good thing. Shredded memory foam pillows are significantly higher or thicker if that helps.
Pillow itself grew on me. You can definitely feel that there is a different material in the center of the pillow. I ordered it as a gift and ended up keeping both pillows. The price tag on this item is absolutely outrageous. I would have never ordered it for myself. Saatva products don’t last in my experience, we got their firmest mattress and within 2 years it was sagging horribly. I am interested to see how long this pillow lasts!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 19, 2026
★★★★★ 2
Side sleeper- lost loft within 2 weeks
Size: Standard/Queen (Pack of 1), Style: High Loft (6"-7")
Side sleeper and within 2 weeks this pillow has lost its loft and has become lumpy. I have spent so much money trying to support my neck and shoulders, this unfortunately is not it. I will continue my search and return this one.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
★★★★★ 4
Mixed Feelings on the Saatva Pillow - A Comprehensive Review
Size: King (Pack of 1), Style: High Loft (6"-7")
Updated Edit (June 2024) : In my quest to find the perfect pillow, I initially purchased the high loft version of this pillow, but it turned out to be a bit too high for my liking. I then decided to try the standard size, and I like it much better! The pillow can still get lumpy and requires fluffing, but opting for the standard lower loft has definitely improved my experience with it. While I still use this pillow occasionally, I generally stick with my Purple Harmony pillow more. Changing my rating to 4 stars.
---
Background:
Over the past 2 years, I have embarked on a journey to find the perfect pillow, testing over ten different options, including numerous high-end brands. My latest trial was the Saatva pillow, renowned for its rave reviews.
Expectations vs. Reality:
Despite its widespread acclaim, my experience with the Saatva pillow did not meet my expectations. I opted for the higher loft variant, aligning with my general preference, yet I found it too high of a lot even as a primary side sleeper.
Material and Comfort:
The Saatva pillow, composed of both latex and down alternative, presented a lumpy texture. This inconsistency resulted in varied support depending on the position of my head. Unlike my regular down alternative pillow, the Saatva required frequent re-fluffing and adjusting throughout the night.
Comparison and Value:
Considering its price and the overwhelming number of positive reviews, my disappointment was notable. Surprisingly, a more affordable down alternative pillow from Amazon outperformed the Saatva in terms of support and comfort, despite the latter's use of higher quality fabrics and its significantly higher cost.
Final Verdict:
This pillow was one of the last in my quest to discover the "best" pillow. Sadly, it ranks in the lower ranks among the high-end, expensive pillows I've tried. I preferred the Purple Harmony pillow over the Saatva, albeit with reservations about the Purple Harmony as well.
Conclusion:
The Saatva pillow, while undoubtedly high-quality and possessing comfortable aspects, did not live up to my expectations, landing it in my pile of unused pillows. It may suit others, but for me, I only give it a 3 out of 5 stars rating.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 26, 2023
★★★★★ 5
Wonderful!
Size: Standard/Queen (Pack of 1), Style: High Loft (6"-7")
I ordered the loftier version of the pillow and I love it! I'm a side sleeper and I've been having pillow issues over the last few years where I swear every pillow is either too tall, too thin, too soft to provide support, to firm and hurts my ears, or the stuffing is too slick or something and migrates away from wherever I put my head. It's been... A time.
But this pillow has been wonderful! I've been using it for a couple weeks now and it's the perfect height for me! The latex inner chamber provides some much needed support, but the softer outer chamber gives me enough cushion to keep my ears from aching.
I will say that, while this is the perfect height for me, personally, I think that if you're someone who prefers a pretty lofty pillow, that this might not be tall enough for you. I ordered the taller version, and it feels right for me, but I've noticed in my pillow buying extravaganza that even pillows that everyone else loves that are designed for side sleepers are usually just too tall for me. So if this pillow is right for me, and you prefer a pretty lofty pillow, I really bet that this won't be tall enough in that case. It's definitely more of a medium loft, rather than a very high loft
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 20, 2024
★★★★★ 5
Read this review. This pillow saved me.
Size: Standard/Queen (Pack of 1), Style: High Loft (6"-7")
I have to testify about this pillow, my brothers and sisters. Ever since I hit my 30s, my body has gone down. Aches and pains. Pops. Crackles. Snaps. It’s ridiculous. Over the last 2 years, I have managed to injure a muscle in my shoulder and the pain is unbearable when it is inflamed. I finally narrowed it down to the pillow I was sleeping on. I have an attachment to a pillow I’ve owned for over 20 years - that’s another story. I could fold it 3 times and it was finally thick enough to support my head. My shoulder got so tore up recently that I had to go through 2 rounds of steroids plus round the clock ibuprofen. Waking up in the night, the whole ordeal. I ordered this pillow after much research all over the internet. I was appalled by the $165 price ticket. But when you’re in that level of pain, you’re just about willing to do whatever it takes. The first night I immediately noticed I got more consecutive hours of sleep than I had in weeks. A week later and my shoulder is pain free. I could’ve cried. The height of this pillow stabilizes my neck and shoulders perfectly. It is firm, but gives and contours to your neck and head. It’s a heavy pillow but I don’t even care. Truly I don’t think I’ll ever go back. This pillow has saved my shoulder and I’ll never stop thanking God for it. If you’re experiencing back, shoulder, or neck pain and are considering this pillow, just order it. Please. Just do it. I’m forever changed. But I’m still keeping 20 year old pillow… just for sentimental purposes. 😂
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 3, 2025