Fc γ RIII/CD16 His Tag Protein, Mouse
SKU: 80233043658

Fc γ RIII/CD16 His Tag Protein, Mouse

Sale price$270.00 Regular price$300.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Fc γ RIII/CD16 His Tag Protein, MouseProduct Specification Species Mouse Antigen Fc RIII CD16 Synonyms CD16, FcRIIIa, FCGR3 Accession Q5D5I8 Amino Acid Sequence Leu32 Thr215, with C terminal 8* His LPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSVRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHTGGGSGGGSHHHHHHHH Expression System HEK293 Molecular Weight 35 45kDa(Reducing) Purity >95% by SDS PAGE

Product Specification


Species Mouse
Antigen Fc γ RIII/CD16
Synonyms CD16, FcγRIIIa, FCGR3
Accession Q5D5I8
Amino Acid Sequence

Leu32- Thr215, with C-terminal 8* His LPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSVRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHTGGGSGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 35-45kDa(Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Anegón I, Cuturi MC, Trinchieri G, Perussia B. Interaction of Fc receptor (CD16) ligands induces transcription of interleukin 2 receptor (CD25) and lymphokine genes and expression of their products in human natural killer cells. J Exp Med. 1988;167(2):452–472.

Background

CD16 (FcγRIIIa) is a type I transmembrane receptor containing two extracellular Ig-like domains. CD16 binds to the Fc portion of IgG antibodies. CD16 is a low affinity IgG receptor mediating antibody-dependent cellular cytotoxicity (ADCC) by NK cells and was also demonstrated to directly recognize unknown tumor ligand. CD16 signals via association with the adaptor molecules CD3z and FcεRγ that contain the activation ITAM motif. The Fc receptor CD16 is the only receptor that can activate resting NK cells when stimulated in isolation. Recently CD16 was reported to be the most potent activating receptor on freshly isolated human NK cells, able to elicit strong cytotoxicity and cytokine production.CD16 is involved in antibody-dependent cell-mediated cytotoxicity and is expressed on large granular lymphocytes (LGLs) of both NK- and T-cell types. CD16 is also expressed at moderate levels on granulocytes, tissue macrophages, and subsets of monocytes, eosinophils, and dendritic cells. CD16 expression is reduced or lost in PNH because of the structural abnormality of anchor membrane protein, GPI. Polymorphisms of the FcγRIIIa gene associated with high or low affinity for Ig Fc have been described that could influence the efficacy of rituximab binding affinity.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 80233043658

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 143 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
Lyla Mae
San Leandro, US
★★★★★ 5
WOW! This printer has been VERY impressive thus far *UPDATE*
Color: Black, Style: ET-2800-B, Pattern Name: Printer
My old printer broke (sooner than I would have liked) so I did A LOT of research before deciding to buy this Epson EcoTank printer for home office use. This is my honest review of it this far and I will definitely update my review if I run into any issues. So far, this printer has been pretty impressive (I've been using it for about a month). The price was pretty average for a printer... but I personally think all printers are overpriced so it was a bit more than I would have liked to spend. It is smaller and more lightweight than I was expecting which is a plus because it takes up less desk space than my previous HP printer. It is very easy to set up, comes with step-by-step easy instructions and guided instructions through the app. It only took me about 10 minutes (Mostly just waiting for the printer to initialize on its own). It is very easy and surprisingly satisfying to fill the ink tank. I like the idea that this ink might last longer than traditional cartridges and won't have as much plastic waste that went along with my old HP Inkjet. I have printed plain black and white documents as well as photos. I print all my photos at home, which is most of the printing that I do, so quality was important to me. The photos came out with pretty good quality! No ink smudges or off colors, colors are bright/vivid, and it is easy to modify what paper you're using with automatic prompts on the printer. Now for the negatives and the reason I'm giving this 4 stars... app to printer connection issues. This was a big issue with my old printer as well. I'm pretty tech savvy and I just have no idea why this is still always an issue for me. There is an extra Epson app that you are supposed to download for printing. Sometimes it can find my printer, sometimes it can't. Sometimes it gives me printer errors or won't let me print documents. And now every time I go to print something it says the paper being used doesn't match the paper settings so I have to bypass that error message (even though it does match in settings and the app, and this happens for both regular paper and photo paper). I've turned everything off and back on again, but the issues with consistent connection and error messages are still an issue. Usually with some fiddling around, I can get the documents/pictures to print but sometimes it feels like I'm jumping through unnecessary hoops. I'm still working out the kinks so if I find some magic solution I'll update my review. Considering this is an issue with most home printers I've used, it's not a deal breaker. All in all, if you are looking for a new home printer, I would definitely recommend this one. The quality has been great for me and I am pleased with my purchase (so far). Hope this helps! *UPDATE*: I have now printed HUNDREDS of photos, they are all excellent quality, and my ink tanks are still mostly full. This is WAY better than my HP printer as far as ink longevity. Changing my review to 5 stars just based on how long this ink lasts. User interface is still a tad annoying but so worth it regardless.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2024
S
Verified Purchase
Sam
Boise, US
★★★★★ 5
Almost a year after purchase and this printer has not let me down!
Color: Black, Style: ET-2800-B, Pattern Name: Printer
I wanted to wait to write a review on this printer to see how it held up over time. Happy to report, after almost a year, it is still working perfectly! I was very nervous about purchasing a printer since it was my first time having to shop for one and almost every printer I looked at had something negative to say about the product. After extensive research, I decided to take a leap with the Epson EcoTank 2800. I was looking for a printer to use for recreational use. Something with decent print quality and longevity as well as something on a reasonable budget. I normally print full pages of color and have been using it regularly for around a year and I have about half of the ink that came with the printer left. Safe to say, the ink lasts a while. The quality may not be the top of the line quality you can get with a more expensive printer, but for the price and just everyday use, the quality is satisfactory. It was easy to set up and walked you through the instructions to connect to devices and configure it. The screen is a little small but if you can overlook that, it really is a nice printer. I have used regular printer paper, card stock, and sticker paper with this printer and I try to load only a few sheets at a time to avoid a jam but I haven't had any issues with it so far. Overall, I am extremely happy with my purchase. It can be extremely difficult to find a decent printer and some reviews can be misleading or leave you with questions on if the product is for you. If you are looking for something for printing everyday with decent quality and ink consumption that won't cost you a fortune, this printer is definitely worth taking a chance on!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2026
H
Verified Purchase
Heavy G
Houston, US
★★★★★ 1
My Epson printer is total junk!
Color: White, Style: ET-2800-W, Pattern Name: Printer
I have had many printers over the years. I started with Canon dot matrix printers, and then ink jet printers. In the old days, and ink cartridge contained all the colors, so if red was out, you tossed away the rest of yellow and blue too. They were pricey and wasting ink wasn't something I was OK with. I would pull ink cartridges from dumpsters outside office supplies stores, take them home and draw the ink from them to fill my cartridges with. Then Epson came up with a cartridge for each color and black . That's when I switched to Epson and have used them ever since. I did have an HP in there when I got such a deal I couldn't pass it by, but after several years it died and I switched to Artisan printers. I still have an old 810 that is finicky and I don't want to have to coax it just to print a few pages. I got a WorkForce printer ,used it several times after I got it, and then it sat idle for 5 years or so. I moved recently and decided to set up the WorkForce printer. The new ink cartridges were practically new, but sat for 5 years maybe, so the nozzles and print head needed cleaning, I expected this. It uses mass amounts of ink to do this so then I was out of ink. I ordered new cartridges, and back to cleaning when they were inside. I never got anything to print, plus, the new paper I ordered was as glossy and slippery as photo paper, and the rollers couldn't grip it. I gave up and ordered this printer as a replacement. Setup went OK until I put paper in, then the rollers were slipping and I got jam messages, even though nothing was inside. I pulled the paper and let it finish the initial process. Then I put paper in when it wanted to align the print head. It fed paper OK for now, so I guess maybe I didn't get hosed on this Epson as I did buying the WorkForce Epson. UPDATE November 1st 2025 This is a frustrating printer!!!! I'm using WIFI network to connect the printer to my laptop computer. I like to be able to print or scan from anywhere in the house. If you purchase this frustrating Epson printer, you now have a ball and chain around your leg. You can't print a simple document without some kind of error code popping up and requiring that go look at the minuscule little screen and try to figure out what button you must press to get the document printed. If I have to be right next to the printer, I might as well use a wired connection. I am disabled and it's a real inconvenience for me to have to go to the printer and squint at the tiny screen to try to figure out why it's been ten minutes of my time and I still haven't gotten my 1 page document in my hand. High speed printing is not high speed when you can't get a printed page without having to make several trips back and forth to the printer. I set the default paper to the standard plain white letter paper, only to find it wants to scan to photo paper, so it just sits there like a block of cement and nothing gets done. I had an Epson Artisan 810 that I really liked, except for the automatic feeder quit working so you had to stand there and feed each sheet to be scanned by hand. I didn't want a sheet feeder on the printer because they break down and the you're feeding by hand anyway. I just hate printing anything at all now because of this printer. I wasted several hours one day trying to print documents that I downloaded and needed a physical copy to present in person for a project I'm doing. Normally I would send a PDF file, and let someone else bother printing if that was necessary. After years of purchasing Epson printers, this is absolutely the last Epson I have spent my money on. Never ever again. The first clue should have been when the quick start guide suggested using a smart phone to set up the printer. I'm not going to work from my 5 x 7 phone screen when I can instead use a 15 inch laptop screen, and keyboard. It's simply a stupid idea. Sorry, but no more Epson for me ever!!!! Update: 4/10/26 This is absolutely the most useless and frustrating Epson printer that I have ever ever owned. I cannot see good close up I need reading glasses to read. The digital screen on this printer is minuscule it's like a postage stamp size absolutely worthless. I have to carry a magnifying glass over to the f****** printer so that I can see what that little miniscule screen has to say on it. The most frustrating thing is every time I want to print something which is rare I don't print things every day the printer is not available is the message I always get I go over there by the printer I turn it off I turn it back on, that should clear out any crap that's on it so it's ready to print right? No you would be dead wrong! Instead you get a stupid little mini School screen and wants to be set on copy mode. I don't want to copy anything I don't want to scan anything I just want the damn thing ready to print. Anyway you come back to your your phone and you want to print and a printer still not available. I literally destroyed my phone I was that pissed off. I'm too old to be frustrated like that all the time. At 75 years of age I have had my share of printers over the years starting with the original dot matrix ones. Absolutely none of them were as difficult to use as this stupid printer I got now from Epson. When you want to print something you should be able to send it to the printer and it should print. You should not require a phone app to set the damn thing up! One thing I'll say, it's pretty good on ink because you can't make the damn thing print when you want it to !!!!!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 10, 2025
D
Verified Purchase
Diana Crossman
West Palm Beach, US
★★★★★ 5
Quality Printer
Color: Black, Style: ET-2800-B, Pattern Name: Printer
Wonderful multi purpose printer. I bought this months ago and finally got it set up. Set up was easy. Love that the printer is so light weight and fairly compact that I can move it wherever if needed. The supply of ink that came with it was awesome. The ink goes a long way. I have printed out a lot of photos on this printer and the quality has been very good. I have not encountered any paper jams. The photo printing has not been smudged nor has the color been uneven. From documents to photos this little printer does it all and does it very well. When my work printer dies I will be replacing it w another Epson Eco Tank for sure.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026
S
Verified Purchase
Scott
Omaha, US
★★★★★ 4
Printing is great, wifi is a problem (I figured out how to make it work!)
Color: White, Style: ET-2800-W, Pattern Name: Printer
I was on the fence about buying this printer because most of the 1 star reviews all said the same thing... "The Wifi would not work" So I followed the instructions, Turned on the print, downloaded the IOS app, connected to the printer via Bluetooth, installed the ink, initialized the printheads. While that was going on, the app asked me to setup the wifi. a List of SSID's came up and I selected the one I wanted. I put in the password and it connected and the icon on the printer turned blue. I have a Unifi setup and I could see that the printer connected to access point #3 @ 2.4ghz and got an ip address. I locked the IP address to the printer. (For my instructions to work for you, you need to make a reservation or lock the ipaddress that your DHCP server provided to the printer. ) If you don't do this, you will get a different address every time you turn the printer on and the computer and app will not be able to find the printer. When the initialization was complete, the app on my phone said it could not connect to the printer. I decided to try to connect to a computer and come back to the phone app. I downloaded the software package from Epson and ran it. When it went to connect to the printer it could not find it and brings up a list of troubleshooting steps that are not likely to do anything. There are videos about this problem and they are all useless. I am an IT professional with 26 years of experience. I am not going to unplug the printer and wait five minutes, I am not going to re-boot my router, I have a Unifi network environment with over 150 devices connected... (I have great wifi coverage, I am not moving my printer anywhere) My network works just fine, this printer is the issue! So at this point, I know that the printer IS connected to my wifi and it got an IP address. This is not a wifi problem as everyone seems to think it is. It is an issue with the Epson software. I decided to try to install it via the windows printer installer. I selected install via TCP/IP and put the ipaddress that my Unifi system provided to the printer. Windows found the printer and since the Epson app had already installed the drivers... just asked me what drivers I wanted to use. The ET-2800 showed up on the right hand side of the screen. I selected it, it installed and I was able to try a test print. It worked fine. I can print from my computer to the printer via the network. Next was the phone app. The phone app has the option to find the printer via the IP address. I put the IP address in and it found the printer. The phone app works now too. So, It took me some time to get this working, it should not have taken any time at all if the software worked correctly. The printer is really nice, it is a shame that the software is so bad when it comes to connecting to the printer. So if you decide to buy one of these printers, save yourself the headache and just install using the ip address, it is quick and easy that way and it just works. I would have just purchased an HP printer, but I did not want to deal with all the issues of their subscription ink service. I feel like the cost of ink makes this printer worth the hassle of getting it to work.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 2, 2024

recommand products