Brain Natriuretic Peptide Protein, Human
SKU: 26208199669

Brain Natriuretic Peptide Protein, Human

Sale price$135.00 Regular price$150.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Brain Natriuretic Peptide Protein, HumanProduct Specification Species Human Synonyms Brain natriuretic peptide 32, Gamma brain natriuretic peptide, B type Natriuretic Peptide, GC B, BNP 32 Accession P16860 Amino Acid Sequence SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH Expression System E. coli Molecular Weight 3. 5 kDa (Reducing) Purity 95%, by SDS PAGE under reducing conditions Endotoxin <1EU g Conjugation Unconjugated Physical Appearance Lyophilized Powder Storage Buffer 20mM Tris HCl, 200mM NaCl,

Product Specification


Species Human
Synonyms Brain natriuretic peptide 32, Gamma-brain natriuretic peptide, B-type Natriuretic Peptide, GC-B, BNP-32
Accession P16860
Amino Acid Sequence

SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

Expression System E.coli
Molecular Weight

3.5 kDa (Reducing)

Purity >95%, by SDS-PAGE under reducing conditions
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris-HCl, 200mM NaCl, pH8.5
Reconstitution

Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Brain-type Natriuretic Peptide (BNP) is a nonglycosylated peptide that is produced predominantly by ventricular myocytes and belongs to the natriuretic peptide family. Proteolytic cleavage of the 12 kDa BNP precursor gives rise to N-terminal Pro BNP (NT-proBNP) and mature BNP. N-terminal proB-type natriuretic peptide (NT-proBNP), a useful marker of heart failure (HF), is considered to be secreted mainly from the ventricle, increased serum NT-proBNP levels are also encountered in conditions such as atrial fibrillation (AF) and atrial septal defect in patients without HF.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 26208199669

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 742 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Chelsea, US
★★★★★ 5
Love, love, love!
Size: Pack of 1, 4 Ounce, Set name: A. Probiotic - Citrus Mint
I love this toothpaste! It has done an amazing job removing plaque. It has helped my sensitivity immediately and I am able to handle cold water or drinks again without any pain. I also love that this is a prebiotic toothpaste.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
N
Verified Purchase
Nunya Bidness
Houston, US
★★★★★ 5
Quality toothpaste with ingredients you can trust
Size: Pack of 1, 4 Ounce, Set name: B. Probiotic - Peppermint, Size: Pack of 1, 4 Ounce, Set name: B. Probiotic - Peppermint
Good toothpaste. It's a nice light scent/flavor. It's pleasant. My teeth feel fresh after using it. I'm excited to see the changes. I'll post a picture of my before and then I'll update in a few months of my after. I'm so grateful this is a natural product that focuses on replenishing rather than just scratching. I still wish it cost less, I mean 14 bucks for one toothpaste seems like a lot, but it's better than using toothpaste that's laced with poison so whatever. I hope one day they come down on their price. I like that the ingredients are quality.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 2, 2026
M
Verified Purchase
Michael Watts
Dallas, US
★★★★★ 5
Great book
Format: Paperback
Great, informative book. Happy to be learning more about this abd how to implement what we learn into our lives.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 25, 2025
L
Verified Purchase
Lyssa
Massapequa, US
★★★★★ 5
Repeating negative patterns in your life? Read this book!
Format: Paperback
I love Cyndi Dale's work and have a number of her books. As a Healing Touch practitioner and Reiki Master I know tons about energy work, chakras, auras, empaths, etc., but again the author took me where I hadn't been before! I am integrating what I've learned from this book into my practice with my clients, and I also use the techniques on myself. For example, I had no idea you could be connected to the land where you were born! I saw where people I know would fall into the personalties (or syndromes) she describes in her book such as the Mule and the Healer. As a student of psychology, I also knew we repeated patterns by our subconscious minds driving us, but I never factored in the additional impact of our energy fields. An excellent book even if you might think you already know it all as a healer.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2018
M
Verified Purchase
M Sloan
Boise, US
★★★★★ 5
Love this book!
Format: Paperback
Very helpful for sensitive people (or for anyone, for that matter) who have trouble with establishing themselves as whole individuals. By that, I mean those of us who are sensitive to energy dynamics that others put out and that we feel keenly, and have a hard time dealing with. It gives solid advice on how to set boundaries, how to empower yourself so that you're not as overwhelmed by external energy dynamics, and explains the whole topic well. I recommend this book.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 30, 2018

recommand products