Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 8 - Jul 13
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
HRP-Labeled ATG4B His Tag Protein, HumanProduct Specification Species Human Synonyms ATG4B, APG4B, AUTL1, AUT like 1 cysteine endopeptidase, Cysteine protease ATG4B, MGC1353 Accession Q9Y4P1 Amino Acid Sequence Met1 Leu393, with N terminal 8*His
Product Specification
| Species | Human |
| Synonyms | ATG4B, APG4B, AUTL1, AUT like 1 cysteine endopeptidase, Cysteine protease ATG4B, MGC1353 |
| Accession | Q9Y4P1 |
| Amino Acid Sequence | Met1-Leu393, with N-terminal 8*His HHHHHHHHMDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRKNFPAIGGTGPTSDTGWGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDSYYSIHQIAQMGVGEGKSIGQWYGPNTVAQVLKKLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRTSVPCAGATAFPADSDRHCNGFPAGAEVTNRPSPWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEPTDGCFIPDESFHCQHPPCRMSIAELDPSIAVGFFCKTEDDFNDWCQQVKKLSLLGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEILSL |
| Expression System | E.coli |
| Molecular Weight | 45kDa |
| Purity | >95% by SDS-PAGE & RP-HPLC |
| Endotoxin | <1EU/μg |
| Conjugation | HRP |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1、Zheng X. et al. (2020) The protease activity of human ATG4B is regulated by reversible oxidative modification. Autophagy. 16(10): 1838-1850. |
Background
Initiation and development of autophagy is modulated by several autophagy-related (ATG) genes, which have been identified in yeast and human. Autophagy begins with the formation and maturation of the double-membraned autophagosomes which engulf and deliver cargoes to lysosomes for degradation. The assembling process of autophagosomes is mediated by a family of core ATG proteins, including two ubiquitin-like systems. First, inactive precursor MAP1LC3/LC3 is cleaved by protease ATG4B at the conserved C-terminal glycine residue. After a set of transfer and activation by ATG7, ATG3 and ATG12-ATG5-ATG16L1, the processed LC3 (LC3-I) finally conjugates with phosphatidylethanolamine (PE) at the exposed glycine site via a covalent bond. So far, lipidated LC3, called LC3-II, has become a biomarker of autophagy because of its characteristic of anchoring into the autophagosome membrane. Upon fusion with lysosomes, ATG4B can, in turn, deconjugate LC3-PE to release LC3-I to the cytoplasm for reuse. Hence, ATG4B serves as a priming and delipidation enzyme whose fine regulation is essential for autophagy process.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.1 ★★★★★
Based on 205 reviews
Sort
Product Reviews
★★★★★ 5
Amazing, effortless, easy!
Excellent experience! I made a claim and they immediately issued an Amazon gift card for reimbursement. Entire process from start to finish was probably 2 minutes or less. Amazing, effortless, easy! Will purchase again for any other items that qualify.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 1, 2025
★★★★★ 5
ASURION 4-Year Housewares Plan - An Excellent ROI
The ASURION 4 Year housewares protection plan was definitely one of the best investments that I've made to date. I had a large, 12,000 BTU portable air conditioner that stopped working properly in its third year of use--one year after the manufacturer's warranty had expired--essentially leaving me with a glorified hot air fan. I proceeded to file a claim on my ASURION 4 Year housewares protection plan. The process could not have been easier and did not require much documentation since the plan was already linked to my prior purchase of the AC off Amazon.
I received an Amazon gift card within minutes of filing the claim, thereby definitively demonstrating ASURION's broad coverage scope, reliability, and overall value.
As such, I used part of the gift card to purchase another four-year plan on a replacement AC unit that's now sitting in my office. Hopefully, I will not need to use it, but it's good to know that I have coverage if needed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2026
★★★★★ 5
Highly recommended
Quick & Easy
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2026
★★★★★ 5
Asurion coverage was worth every penny!
Bought a window AC in 2020 and was offered Asurion coverage at checkout. Paid $39 for the 4 year plan and never expceted it would be worth the money paid. Honestly, never expected to even use it. That said...the AC failed about 2 years later so I made a claim online. The claim went in but required a call to an Asurion rep (very nice guy on the phone). He asked a few questions then told me the claim was approved. Total time to for the entire process was about 15 mins. I had the choice of having it repaired or a refund check. I asked for the refund. An emailed pre-paid UPS label was recieved a few minites later and the guy said they'd mail me a check when the UPS package was received, so I dropped it off at UPS. Three weeks later I had a check in my hand for $399 (the excact cost I paid for the AC unit 2 years before minus taxes paid). Really easy process and quick time to receive the check. The only thing to note is that if you make a purchase like that (large electronic or home appliance)...keep that box and packaging. Luckily I had it all and just popped it back into the box for shipment. Not sure how I would have dealt with that if I hadn't saved the box. Thank you Asurion, for delivering on your promise of quick and easy extended warranty payment. I'll defintely purchase the plan again with my replacement AC!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 20, 2023
★★★★★ 5
Best warranty ever.
Outstanding. No questions asked.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 4, 2026